PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA09G0076200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bHLH
Protein Properties Length: 509aa    MW: 50020.9 Da    PI: 7.0636
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA09G0076200.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH35.51.7e-11266314555
                        HHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
                HLH   5 hnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                        h+++Er RR+ri +++  L+el+P+a  ++    +Ka++L + ++Y+k Lq
  ORGLA09G0076200.1 266 HSIAERLRRERIAERMKALQELVPNA--NKLMQTDKASMLDEIIDYVKFLQ 314
                        99***********************7..48888*****************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd000832.98E-12259318No hitNo description
SuperFamilySSF474599.95E-16259324IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088816.787261313IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.109.0E-15265319IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000108.3E-9266314IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003539.9E-13267319IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048767Biological Processroot hair elongation
GO:0005634Cellular Componentnucleus
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 509 aa     Download sequence    Send to blast
MQAMAAAAAA GQISLDDLRN GGGVAANAAG GGGVHDDFLD QMLSSLPPSA WPDLAAGKAA  60
EDDAEGMHHH HHQQQQQFGG PYDESAMLAS RLRQHQISGG GGGGGGGAAA VKQMVLQQLA  120
DLRQGHHMML QGLGGRSPAG GGGGGGDGGL LLPLTLGSGG SGGDVQALLK AAAANSAGGG  180
DAGGVYGGGF AGSLHQQQQH FQPHPQLQTA PTIPTQSFGG GGGGGGGGTA SGGGAAQPQA  240
GAAGGGAPAP PRQRVRARRG QATDPHSIAE RLRRERIAER MKALQELVPN ANKLMQTDKA  300
SMLDEIIDYV KFLQLQVKAS TYTKLLIHVL SMSRLGGAAA VAPLVADMSS EGRGGGAANG  360
GAPAAAAAAA GSDSLTVTEQ QVAKLMEEDM GTAMQYLQGK GLCLMPISLA SAISSATCHL  420
RPPVVAAAAA QQFPAGLGAA AAAAHHHQLS AAAAAAMRGH LPGLNADGSV PASPSMSVLT  480
AQSAMANGGG GAADGEGSQL KDAASVSKP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1133141GGRSPAGGG
2270275RLRRER
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0057840.0AP005784.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, PAC clone:P0014G10.
GenBankAP0149650.0AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015610784.11e-180PREDICTED: transcription factor UNE12 isoform X1
TrEMBLI1QNY30.0I1QNY3_ORYGL; Uncharacterized protein
STRINGORGLA09G0076200.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141937118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24260.13e-44LJRHL1-like 1